PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN10475.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bHLH
Protein Properties Length: 273aa    MW: 31426.5 Da    PI: 8.4918
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN10475.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH42.41.2e-13101153155
                 CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
         HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                 +++ h+e+Er+RR+++ + ++ Lr+llP  +   ++K s ++   +Av+YIk++q
  KHN10475.1 101 KKMIHKEIERQRRQEMATFYASLRSLLPLEF--IKGKRSISDHMNEAVNYIKHMQ 153
                 5788*************************65..*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.57E-1399171IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088813.503100152IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000833.51E-9100154No hitNo description
PfamPF000108.5E-11101153IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.1E-10102172IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003535.2E-6106158IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MNLLPSAPIS KVDDSLEHSL SFESTMFPLQ RGNELVIQFS NSPHHHLQHK MSQDLILDDY  60
ASLDANDSNQ KFSTSSISQP TKKLFYGANK KNHDYSNEHK KKMIHKEIER QRRQEMATFY  120
ASLRSLLPLE FIKGKRSISD HMNEAVNYIK HMQKHIKELG AKRDELKKLS NHSNNMENNH  180
EGLHTSCNFT VHEKNGIMGI EITSVFREEK PKISKLLQFL TEEGLEVVSF FSTEVNGRLL  240
HSVQCEVNHS NSVDPSELRK KVSKAFSTFR CSD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150443e-98AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534029.20.0PREDICTED: transcription factor bHLH118-like
TrEMBLA0A0B2PMY50.0A0A0B2PMY5_GLYSO; Transcription factor bHLH118
STRINGGLYMA09G27630.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79233125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25410.15e-34bHLH family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]